.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ne3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of ribosomal protein S28E from Methanobacterium thermoautotrophicum. Protein Sci. 12 2831-2837 2003
    Site NESGC
    PDB Id 1ne3 Target Id TT744
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS31719,2.40.50.140, 5620, PF01200 Molecular Weight 7666.63 Da.
    Residues 68 Isoelectric Point 6.22
    Sequence mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtireakeirtp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ne3
    1. Structural proteomics: toward high-throughput structural biology as a tool in functional genomics
    A Yee, K Pardee, D Christendat - Accounts of chemical , 2003 - ACS Publications
     
    2. A topology_constrained distance network algorithm for protein structure determination from NOESY data
    YJ Huang, R Tejero, R Powers - PROTEINS: Structure, , 2006 - Wiley Online Library
     
    3. Sequence specific resonance assignment via Multicanonical Monte Carlo search using an ABACUS approach
    A Lemak, CA Steren, CH Arrowsmith - Journal of biomolecular , 2008 - Springer
     
    4. Solution NMR structure of the 30S ribosomal protein S28E from Pyrococcus horikoshii
    JM Aramini, YJ Huang, JR Cort - Protein , 2003 - Wiley Online Library
     
    5. Solution structure of ribosomal protein S28E from Methanobacterium thermoautotrophicum
    B Wu, A Yee, A Pineda_Lucena, A Semesi - Protein , 2003 - Wiley Online Library
     
    6. SIMILARITY SEARCH AND ANALYSIS OF PROTEIN SEQUENCES AND STRUCTURES: A RESIDUE CONTACTS BASED APPROACH
    ASAC AN - 2008 - etd.lib.metu.edu.tr
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    8. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch