.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ni7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-quality homology models derived from NMR and X-ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family are enhancers of cysteine desulfurases. Protein Sci. 14 1597-1608 2005
    Site NESGC
    PDB Id 1ni7 Target Id ER75
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8864,3.90.1010.10, 5630, PF02657 Molecular Weight 15939.40 Da.
    Residues 147 Isoelectric Point 6.11
    Sequence mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwlgy tvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsasrsqglnalse aiiaatkqv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ni7
    1. Solution NMR structure of the iron-sulfur cluster assembly protein U (IscU) with zinc bound at the active site
    TA Ramelot, JR Cort, S Goldsmith-Fischman - Journal of molecular , 2004 - Elsevier
     
    2. Protein NMR recall, precision, and F-measure scores (RPF scores): structure quality assessment measures based on information retrieval statistics
    YJ Huang, R Powers - Journal of the American , 2005 - ACS Publications
     
    3. Analysis of the heteromeric CsdA-CsdE cysteine desulfurase, assisting Fe-S cluster biogenesis in Escherichia coli
    L Loiseau, S Ollagnier-de Choudens, D Lascoux - Journal of Biological , 2005 - ASBMB
     
    4. The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes
    S Goldsmith-Fischman, A Kuzin, WC Edstrom - Journal of molecular , 2004 - Elsevier
     
    5. High_quality homology models derived from NMR and X_ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family
    G Liu, Z Li, Y Chiang, T Acton, GT Montelione - Protein , 2005 - Wiley Online Library
     
    6. Expression, crystallization and preliminary crystallographic analysis of SufE (XAC2355) from Xanthomonas axonopodis pv. citri
    CR Guzzo, LR Silva, LMP Galvo-Botton - Section F: Structural , 2006 - scripts.iucr.org
     
    7. Proteomic Analysis of Protein-Protein Interactions within the CSD Fe-S Cluster Biogenesis System
    HM Bolstad, DJ Botelho, MJ Wood - Journal of proteome research, 2010 - ACS Publications
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch