.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nkv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF YJHP FROM E.COLI NORTHEAST STRUCTURAL GENOMICS RESEARCH CONSORTIUM (NESG) TARGET ER13. To be published
    Site NESGC
    PDB Id 1nkv Target Id ER13
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8830,PF08241, PF02353, 3.40.50.150, PF07021, PF01135 Molecular Weight 27352.50 Da.
    Residues 248 Isoelectric Point 4.90
    Sequence mdipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgitgtgidmss lftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfagaeellaqslkpggimli gepywrqlpateeiaqacgvsstsdfltlpglvgafddlgydvvemvladqegwdryeaakwltmrrwl eanpdddfaaevraelniapkryvtyarecfgwgvfaliar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.29
    Matthews' coefficent 2.35 Rfactor 0.22
    Waters 111 Solvent Content 47.35

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nkv
    1. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    2. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    3. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    4. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch