.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nr3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title SOLUTION STRUCTURE OF THE PROTEIN MTH0916: THE NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET TT212. To be Published
    Site NESGC
    PDB Id 1nr3 Target Id TT212
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9201,1.10.260.40, 1.10.10.10, 5657, 3.30.1190.10 Molecular Weight 14160.62 Da.
    Residues 122 Isoelectric Point 9.77
    Sequence mrergwsqkkiarelkttrqnvsaierkamenieksrntldfvkslkspvrilcrrgdtldeiikrlle esnkegihvihdsitlaflirekashrivhrvvksdfeigvtrdgeiivdlns
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nr3
    1. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    2. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    3. Structural Differences between Proteins with Similar Sequences
    Q Cong, BH Kim, LN Kinch - (BIBE), 2010 IEEE , 2010 - ieeexplore.ieee.org
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    5. ENZYME INHIBITING COMPOUNDS AND METHODS
    E Olafield, K Wang, W Wang, Y Zhang - US Patent App. 13/500,845, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch