.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ns5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YBEA from E. coli. To be Published
    Site NESGC
    PDB Id 1ns5 Target Id ER45
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8851,PF02590, 3.40.1280.10 Molecular Weight 17340.17 Da.
    Residues 155 Isoelectric Point 8.71
    Sequence mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqmlaaagknri vtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqswslsaltlphplvrvlvae slyrawsittnhpyhre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.68 Rfree 0.213
    Matthews' coefficent 1.86 Rfactor 0.145
    Waters 409 Solvent Content 33.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ns5
    1. Intricate knots in proteins: Function and evolution
    P Virnau, LA Mirny, M Kardar - PLoS computational biology, 2006 - dx.plos.org
     
    2. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. Structure and Function of the Antibiotic Resistance-mediating Methyltransferase AviRb from Streptomyces viridochromogenes
    TG Mosbacher, A Bechthold, GE Schulz - Journal of molecular biology, 2005 - Elsevier
     
    4. Database searching by flexible protein structure alignment
    Y Ye, A Godzik - Protein science, 2004 - Wiley Online Library
     
    5. PDB
    M Von Grotthuss, D Plewczynski, K Ginalski - BMC , 2006 - biomedcentral.com
     
    6. Identification of pseudouridine methyltransferase in Escherichia coli
    R Ero, L Peil, A Liiv, J Remme - Rna, 2008 - rnajournal.cshlp.org
     
    7. YbeA is the m3_ methyltransferase RlmH that targets nucleotide 1915 in 23S rRNA
    E Purta, KH Kaminska, JM Kasprzak, JM Bujnicki - RNA, 2008 - rnajournal.cshlp.org
     
    8. Rapid knot detection and application to protein structure prediction
    F Khatib, MT Weirauch, CA Rohl - Bioinformatics, 2006 - Oxford Univ Press
     
    9. How does a knotted protein fold?
    AL Mallam - FEBS Journal, 2009 - Wiley Online Library
     
    10. Experimental detection of knotted conformations in denatured proteins
    AL Mallam, JM Rogers - Proceedings of the , 2010 - National Acad Sciences
     
    11. Structures and folding pathways of topologically knotted proteins
    P Virnau, A Mallam, S Jackson - Journal of Physics: Condensed , 2011 - iopscience.iop.org
     
    12. 3D-Fun: predicting enzyme function from structure
    M Von Grotthuss, D Plewczynski, G Vriend - Nucleic Acids , 2008 - Oxford Univ Press
     
    13. What lessons can be learned from studying the folding of homologous proteins?
    AA Nickson, J Clarke - Methods, 2010 - Elsevier
     
    14. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    15. Folds and functions of domains in RNA modification enzymes
    A Czerwoniec, JM Kasprzak - DNA and RNA , 2009 - asia.genesilico.pl
     
    16. Knot formation in newly translated proteins is spontaneous and accelerated by chaperonins
    AL Mallam, SE Jackson - Nature Chemical Biology, 2011 - nature.com
     
    17. 1 Protein methyltransferases: Their distribution among the five structural classes of adomet-dependent methyltransferases
    HL Schubert, RM Blumenthal, X Cheng - The Enzymes, 2006 - Elsevier
     
    18. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    19. Spectral markers for knotted core of proteins
    P Lissy Anto, AS Nair - CIB'2009, 2009 - cls.zju.edu.cn
     
    20. The Conformational Relationship between Knotted Proteins and Corresponding mRNA Templates
    RH Hung - 2007 - etdncku.lib.ncku.edu.tw
     
    21. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch