.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nwb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the hypothetical protein AQ-1857 encoded by the Y157 gene from Aquifex aeolicus reveals a novel protein fold. Proteins 54 794-796 2004
    Site NESGC
    PDB Id 1nwb Target Id QR6
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9041,2.60.300.12, PF01521, 5683 Molecular Weight 12659.58 Da.
    Residues 116 Isoelectric Point 4.33
    Sequence mqeqaqqfifkvtdkaveeikkvaqennienpilrirvvpggcsgfqyamgfddtveegdhvfeydgvk vvidpfsmpyvngaeldyvvdfmgggftirnpnatgscgcgssfscg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nwb
    1. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    2. DsrR, a novel IscA-like protein lacking iron-and Fe-S-binding functions, involved in the regulation of sulfur oxidation in Allochromatium vinosum
    F Grimm, JR Cort, C Dahl - Journal of bacteriology, 2010 - Am Soc Microbiol
     
    3. NMR structure of the hypothetical protein AQ_1857 encoded by the Y157 gene from Aquifex aeolicus reveals a novel protein fold
    D Xu, G Liu, R Xiao, T Acton - Proteins: Structure, , 2004 - Wiley Online Library
     
    4. Letter to the Editor: NMR assignment of HI1723 from Haemophilus influenzaea sequence homologue from the iron sulfur cluster assembly (IscA) family
    DC Yeh, F Liu, N Bonander, E Eisenstein - Journal of Biomolecular , 2004 - Springer
     
    5. DsrR, a novel IscA-like protein lacking iron-and 1
    F Grimm, JR Cort, C Dahl - 2010 - Am Soc Microbiol
     
    6. Studies of structure, hydration and dynamics of biological macromolecules by use of NMR spectroscopy
    D Xu - 2007 - books.google.com
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch