.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nxh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF MTH396. To be Published
    Site NESGC
    PDB Id 1nxh Target Id TT87
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9215,1.10.3070.10, PF09218 Molecular Weight 14956.33 Da.
    Residues 126 Isoelectric Point 4.75
    Sequence mdegelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesarprcire klhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.319
    Matthews' coefficent 2.81 Rfactor 0.226
    Waters Solvent Content 56.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nxh
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch