.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nxi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Vibrio cholerae protein VC0424: a variation of the ferredoxin-like fold. Protein Sci. 12 1556-1561 2003
    Site NESGC
    PDB Id 1nxi Target Id OP3
    Molecular Characteristics
    Source Other
    Alias Ids TPS8992,5589, PF06877, 3.30.70.970 Molecular Weight 14257.93 Da.
    Residues 124 Isoelectric Point 3.98
    Sequence mshqddylsveelieiqkeetrdiiqalledgsdpdalyeiehhlfaedfdklekaaveafkmgfevle aeetededgnkllcfdatmqsaldaklideqveklvnlaekfdiiydgwgtyyeg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nxi
    1. SPARTA+: a modest improvement in empirical NMR chemical shift prediction by means of an artificial neural network
    Y Shen, A Bax - Journal of biomolecular NMR, 2010 - Springer
     
    2. Solution structure of Vibrio cholerae protein VC0424: A variation of the ferredoxin_like fold
    TA Ramelot, S Ni, S Goldsmith_Fischman - Protein , 2003 - Wiley Online Library
     
    3. The solution structure of the core of mesoderm development (MESD), a chaperone for members of the LDLR-family
    C Khler, OM Andersen, A Diehl, G Krause - Journal of structural and , 2006 - Springer
     
    4. Identification of helix capping and _-turn motifs from NMR chemical shifts
    Y Shen, A Bax - Journal of Biomolecular NMR, 2012 - Springer
     
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    6. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch