.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nxu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Novel NAD-binding Protein Revealed by the Crystal Structure of 2,3-Diketo-L-gulonate Reductase (YiaK). J.Biol.Chem. 279 13148-13155 2004
    Site NESGC
    PDB Id 1nxu Target Id ER82
    Related PDB Ids 1s20 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8865,1.10.1530.10, 3.30.60.50, PF02615, 3.30.1370.60 Molecular Weight 36570.74 Da.
    Residues 332 Isoelectric Point 5.19
    Sequence mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengdiipdaqpkr itslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrggsygwqaaekgyigicwt nsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsygmlevnrlagrqlpvdggfddegnltk epgvieknrrilpmgywkgsgmsivldmiatllsdgasvaevtqdnsdeygisqifiaievdklidgpt rdaklqrimdyvtsaeradenqairlpghefttllaenrrngitvddsvwakiqal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.235
    Matthews' coefficent 1.93 Rfactor 0.192
    Waters 664 Solvent Content 35.83

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1nxu
    1. Methanoarchaeal sulfolactate dehydrogenase: prototype of a new family of NADH-dependent enzymes
    A Irimia, D Madern, G Zacca, FMD Vellieux - The EMBO journal, 2004 - nature.com
     
    2. Crystal Structures of _1-Piperideine-2-carboxylate/_1-Pyrroline-2-carboxylate Reductase Belonging to a New Family of NAD (P) H-dependent Oxidoreductases
    M Goto, H Muramatsu, H Mihara, T Kurihara - Journal of Biological , 2005 - ASBMB
     
    3. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch