.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nxz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional assignment based on structural analysis: crystal structure of the yggJ protein (HI0303) of Haemophilus influenzae reveals an RNA methyltransferase with a deep trefoil knot. Proteins 53 329-332 2003
    Site NESGC
    PDB Id 1nxz Target Id IR73
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8940,PF04452, 2.40.240.20, 3.40.1280.10 Molecular Weight 27371.15 Da.
    Residues 245 Isoelectric Point 6.67
    Sequence mripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksvkveilgr eladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqkiaiaa ceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrlligsegglsaqeiaq teqqgfteillgkrvlrtetaslaaisalqicfgdlge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.264
    Matthews' coefficent 2.23 Rfactor 0.214
    Waters 320 Solvent Content 44.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nxz
    1. Identification and characterization of RsmE, the founding member of a new RNA base methyltransferase family
    GN BASTUREA, KE RUDD, MP DEUTSCHER - Rna, 2006 - rnajournal.cshlp.org
     
    2. Functional annotation by identification of local surface similarities: a novel tool for structural genomics
    F Ferr, G Ausiello, A Zanzoni - BMC , 2005 - biomedcentral.com
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Structure and Function of the Antibiotic Resistance-mediating Methyltransferase AviRb from Streptomyces viridochromogenes
    TG Mosbacher, A Bechthold, GE Schulz - Journal of molecular biology, 2005 - Elsevier
     
    5. Database searching by flexible protein structure alignment
    Y Ye, A Godzik - Protein science, 2004 - Wiley Online Library
     
    6. Functional assignment based on structural analysis: crystal structure of the yggJ protein (HI0303) of Haemophilus influenzae reveals an RNA methyltransferase with a
    F Forouhar, J Shen, R Xiao, TB Acton - Proteins: Structure, , 2003 - Wiley Online Library
     
    7. Active site identification through geometry-based and sequence profile-based calculations: burial of catalytic clefts
    R Greaves, J Warwicker - Journal of molecular biology, 2005 - Elsevier
     
    8. Substrate specificity and properties of the Escherichia coli 16S rRNA methyltransferase, RsmE
    GN Basturea, MP Deutscher - RNA, 2007 - rnajournal.cshlp.org
     
    9. Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
    C Lw, P Neumann, H Tidow, U Weininger - Journal of molecular , 2010 - Elsevier
     
    10. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    11. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    12. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    13. Crystal structure of Mj1640/DUF358 protein reveals a putative SPOUT-class RNA methyltransferase
    HY Chen, YA Yuan - Journal of Molecular Cell Biology, 2010 - jmcb.oxfordjournals.org
     
    14. Folds and functions of domains in RNA modification enzymes
    A Czerwoniec, JM Kasprzak - DNA and RNA , 2009 - asia.genesilico.pl
     
    15. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    16. Insights into the Catalytic Mechanism of 16S rRNA Methyltransferase RsmE (m 3 U1498) from Crystal and Solution Structures
    H Zhang, H Wan, ZQ Gao, Y Wei, WJ Wang - Journal of Molecular , 2012 - Elsevier
     
    17. Spectral markers for knotted core of proteins
    P Lissy Anto, AS Nair - CIB'2009, 2009 - cls.zju.edu.cn
     
    18. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    19. The Conformational Relationship between Knotted Proteins and Corresponding mRNA Templates
    RH Hung - 2007 - etdncku.lib.ncku.edu.tw
     
    20. Biochemie und Molekularbiologie 2003
    N Strter, T Maier, A Skerra, K Schrrle - Nachrichten aus der , 2004 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch