.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ny1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Polysaccharide Deacetylase (PDAA_BACSU) from B. Subtilis (Pdaa_Bacsu) Northeast Structural Genomics Research Consortium (Nesg) Target Sr127. To be Published
    Site NESGC
    PDB Id 1ny1 Target Id SR127
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9062,3.20.20.370, PF01522 Molecular Weight 30067.75 Da.
    Residues 263 Isoelectric Point 7.15
    Sequence mkwmcsiccaavllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiy ltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadq iqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkkyayd hmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.212
    Matthews' coefficent 2.41 Rfactor 0.182
    Waters 530 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ny1
    1. Distinguishing enzyme structures from non-enzymes without alignments
    PD Dobson, AJ Doig - Journal of molecular biology, 2003 - Elsevier
     
    2. Structures of Bacillus subtilis PdaA, a family 4 carbohydrate esterase, and a complex with N-acetyl-glucosamine
    DE Blair, DMF van Aalten - FEBS letters, 2004 - Elsevier
     
    3. The putative chitin deacetylase of Encephalitozoon cuniculi: A surface protein implicated in microsporidian spore_wall formation
    D Brosson, L Kuhn, G Prensier - FEMS microbiology , 2005 - Wiley Online Library
     
    4. A polysaccharide deacetylase homologue, PdaA, in Bacillus subtilis acts as an N-acetylmuramic acid deacetylase in vitro
    T Fukushima, T Kitajima, J Sekiguchi - Journal of bacteriology, 2005 - Am Soc Microbiol
     
    5. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    6. The cyst wall of Entamoeba invadens contains chitosan (deacetylated chitin)
    S Das, K Van Dellen, D Bulik, P Magnelli, J Cui - Molecular and , 2006 - Elsevier
     
    7. Structure of the novel-amylase AmyC from Thermotoga maritima
    A Dickmanns, M Ballschmiter, W Liebl - Section D: Biological , 2006 - scripts.iucr.org
     
    8. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    9. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    10. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch