.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o0i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF YB61_HAEIN NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET IR63.
    Site NESGC
    PDB Id 1o0i Target Id IR63
    Related PDB Ids 2b6e 
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8938,3.10.129.10 Molecular Weight 15050.58 Da.
    Residues 138 Isoelectric Point 6.40
    Sequence mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsvalaetigslag slcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirteenklccvsrltlsvinl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.228
    Matthews' coefficent 2.33 Rfactor 0.185
    Waters 243 Solvent Content 46.87

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch