.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oy1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105. To be Published
    Site NESGC
    PDB Id 1oy1 Target Id ER105
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8820,PF01965, 3.40.50.880 Molecular Weight 23325.64 Da.
    Residues 220 Isoelectric Point 4.67
    Sequence mitmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtetrnvlie aaritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkalaqamhqagkplgfmc iapamlpkifdfplrltigtdidtaevleemgaehvpcpvddivvdednkivttpaymlaqniaeaasg idklvsrvlvlae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.95 Rfree 0.265
    Matthews' coefficent 2.38 Rfactor 0.216
    Waters 14 Solvent Content 47.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oy1
    1. Evolutionary and functional relationships within the DJ1 superfamily
    S Bandyopadhyay, M Cookson - BMC evolutionary biology, 2004 - biomedcentral.com
     
    2. Identification of functional subclasses in the DJ-1 superfamily proteins
    Y Wei, D Ringe, MA Wilson - PLoS computational , 2007 - dx.plos.org
     
    3. Active site identification through geometry-based and sequence profile-based calculations: burial of catalytic clefts
    R Greaves, J Warwicker - Journal of molecular biology, 2005 - Elsevier
     
    4. Evolutionary Dynamics of ProteinProtein Interactions
    LS Swapna, B Offmann - Knowledge Discovery in , 2007 - Wiley Online Library
     
    5. Dissection of the dimerization modes in the DJ-1 superfamily
    HJ Jung, S Kim, YJ Kim, MK Kim, SG Kang, JH Lee - Molecules and , 2012 - Springer
     
    6. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch