.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF YIBA_ECOLI NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ET31. To be Published
    Site NESGC
    PDB Id 1oyz Target Id ET31
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8870,1.25.10.10, PF03130, PF02985 Molecular Weight 31871.80 Da.
    Residues 280 Isoelectric Point 8.65
    Sequence msntyqkrkaskeyglynqckklnddelfrllddhnslkrissarvlqlrggqdavrlaiefcsdknyi rrdigafilgqikickkcednvfnilnnmalndksacvrataiestaqrckknpiyspkiveqsqitaf dkstnvrratafaisvindkatipllinllkdpngdvrnwaafaininkydnsdirdcfvemlqdknee vrieaiiglsyrkdkrvlsvlcdelkkntvyddiieaagelgdktllpvldtmlykfddneiitsaidk lkrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.269
    Matthews' coefficent 2.37 Rfactor 0.219
    Waters 58 Solvent Content 47.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oyz
    1. The post-translational synthesis of a polyamine-derived amino acid, hypusine, in the eukaryotic translation initiation factor 5A (eIF5A)
    MH Park - Journal of biochemistry, 2006 - Jpn Biochemical Soc
     
    2. Molecular cloning, expression, and structural prediction of deoxyhypusine hydroxylase: a HEAT-repeat-containing metalloenzyme
    JH Park, L Aravind, EC Wolff, J Kaevel - Proceedings of the , 2006 - National Acad Sciences
     
    3. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. Structural insight into repair of alkylated DNA by a new superfamily of DNA glycosylases comprising HEAT-like repeats
    B Dalhus, IH Helle, PH Backe, I Alseth - Nucleic acids , 2007 - Oxford Univ Press
     
    6. Molecular cloning and functional expression of bovine deoxyhypusine hydroxylase cDNA and homologs
    JK Huang, Y Cui, CH Chen, D Clampitt, CT Lin - Protein expression and , 2007 - Elsevier
     
    7. MTH187 from Methanobacterium thermoautotrophicum has three HEAT-like repeats
    O Julien, I Gignac, A Hutton, A Yee - Journal of biomolecular , 2006 - Springer
     
    8. Exploring the Role of CH. Interactions on the Structural Stability of Single Chain All-Alpha Proteins
    V Shanthi, K Ramanathan - Applied biochemistry and , 2010 - Springer
     
    9. Understanding the role of the topology in protein folding by computational inverse folding experiments
    A Mucherino, S Costantini, D di Serafino - Biology and Chemistry, 2008 - Elsevier
     
    10. A Unique Modification of the Eukaryotic Initiation Factor 5A Shows the Presence of the Complete Hypusine Pathway in Leishmania donovani
    B Chawla, RR Kumar, N Tyagi, G Subramanian - PLos One, 2012 - dx.plos.org
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch