.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p91

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site. Proc.Natl.Acad.Sci.Usa 101 4041-4046 2004
    Site NESGC
    PDB Id 1p91 Target Id ER19
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8834,PF01209, PF08241, PF02390, PF05175, 3.40.50.150 Molecular Weight 30417.27 Da.
    Residues 269 Isoelectric Point 6.82
    Sequence msfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarrafldaghyqp lrdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskvaikaaakrypqvtfcvas shrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgprhlmelkgliynevhlhaphaeqleg ftlqqsaelcypmrlrgdeavallqmtpfawrakpevwqtlaakevfdcqtdfnihlwqrsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.296
    Matthews' coefficent 3.81 Rfactor 0.248
    Waters 85 Solvent Content 67.68

    Ligand Information
    Ligands SO4 (SULFATE) x 5;SAM (S-ADENOSYLMETHIONINE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1p91
    1. Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site
    K Das, T Acton, Y Chiang, L Shih - Proceedings of the , 2004 - National Acad Sciences
     
    2. Performance of ZDOCK and ZRANK in CAPRI rounds 1319
    H Hwang, T Vreven, BG Pierce - Proteins: Structure, , 2010 - Wiley Online Library
     
    3. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     
    4. A generalized approach to sampling backbone conformations with RosettaDock for CAPRI rounds 1319
    A Sircar, S Chaudhury, KP Kilambi - Proteins: Structure, , 2010 - Wiley Online Library
     
    5. MDockPP: A hierarchical approach for protein_protein docking and its application to CAPRI rounds 1519
    SY Huang, X Zou - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch