.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pg6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of hypothetical protein SPYM3_0169 from Streptococcus pyogenes. To be Published 2003
    Site NESGC
    PDB Id 1pg6 Target Id DR2
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8814,PF01987 Molecular Weight 25504.66 Da.
    Residues 236 Isoelectric Point 5.53
    Sequence mvdnrmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklngkgsglgklvgaigrsmvs gesmfitqamsngdgklalapntpgqivalelgekqyrlndgaflaldgsaqykmerqnigkalfggqg glfvmtteglgtllansfgsikkitldggtmtidnahvvawsreldydihlengfmqsigtgegvvntf rghgeiyiqslnleqfagtlkrylptssn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.244
    Matthews' coefficent 2.06 Rfactor 0.213
    Waters 182 Solvent Content 39.80

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 1pg6
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch