.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18. To be Published
    Site NESGC
    PDB Id 1pqx Target Id ZR18
    Related PDB Ids 2ffm 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9270,PF08712, 3.30.1370.70 Molecular Weight 9406.15 Da.
    Residues 83 Isoelectric Point 4.65
    Sequence mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdfisvdkenda nwetvlpkveavfe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pqx
    1. A large data set comparison of protein structures determined by crystallography and NMR: statistical test for structural differences and the effect of crystal packing
    M Andrec, DA Snyder, Z Zhou, J Young - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. FAST-NMR: functional annotation screening technology using NMR spectroscopy
    KA Mercier, M Baran, V Ramanathan - Journal of the , 2006 - ACS Publications
     
    3. The application of FAST-NMR for the identification of novel drug discovery targets
    R Powers, KA Mercier, JC Copeland - Drug discovery today, 2008 - Elsevier
     
    4. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    5. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    6. Class IIc or Circular Bacteriocins
    LA Martin-Visscher, MJ Belkum, JC Vederas - Prokaryotic Antimicrobial , 2011 - Springer
     
    7. SPINS: a laboratory information management system for organizing and archiving intermediate and final results from NMR protein structure determinations
    MC Baran, HNB Moseley, JM Aramini - Proteins: Structure, , 2006 - Wiley Online Library
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch