.
The Open Protein Structure Annotation Network
PDB Keyword
.

1puz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle. Proteins 55 756-758 2004
    Site NESGC
    PDB Id 1puz Target Id MR19
    Molecular Characteristics
    Source Neisseria meningitidis
    Alias Ids TPS8959,PF03937, 1.10.150.250, 5846 Molecular Weight 9793.83 Da.
    Residues 82 Isoelectric Point 5.34
    Sequence mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellalinghsetdk ghlipmlekirra
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1puz
    1. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    2. NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis Reveals a distinct 5_helix bundle
    G Liu, DK Sukumaran, D Xu, Y Chiang - Proteins: Structure, , 2004 - Wiley Online Library
     
    3. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    4. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch