.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q48

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the iron-sulfur cluster assembly protein U (IscU) with zinc bound at the active site. J.Mol.Biol. 344 567-583 2004
    Site NESGC
    PDB Id 1q48 Target Id IR24
    Related PDB Ids 1r9p 
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8935,3397, 3.90.1010.10, 5842, PF01592 Molecular Weight 13398.46 Da.
    Residues 126 Isoelectric Point 4.99
    Sequence maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfktygcgsaias sslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiadykakqg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q48
    1. Iron-sulfur cluster biosynthesis: toward an understanding of cellular machinery and molecular mechanism
    SS Mansy, JA Cowan - Accounts of chemical research, 2004 - ACS Publications
     
    2. Metalloproteomics: high-throughput structural and functional annotation of proteins in structural genomics
    W Shi, C Zhan, A Ignatov, BA Manjasetty, N Marinkovic - Structure, 2005 - Elsevier
     
    3. Predictive reconstruction of the mitochondrial iron_sulfur cluster assembly metabolism. II. Role of glutaredoxin Grx5
    R Alves, E Herrero, A Sorribas - Proteins: Structure, Function, , 2004 - Wiley Online Library
     
    4. The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes
    S Goldsmith-Fischman, A Kuzin, WC Edstrom - Journal of molecular , 2004 - Elsevier
     
    5. Bacterial IscU is a well folded and functional single domain protein
    S Adinolfi, F Rizzo, L Masino, M Nair - European Journal of , 2004 - Wiley Online Library
     
    6. High_quality homology models derived from NMR and X_ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family
    G Liu, Z Li, Y Chiang, T Acton, GT Montelione - Protein , 2005 - Wiley Online Library
     
    7. Ironsulfur cluster biosynthesis: characterization of IscUIscS complex formation and a structural model for sulfide delivery to the [2Fe2S] assembly site
    M Nuth, JA Cowan - Journal of Biological Inorganic Chemistry, 2009 - Springer
     
    8. The PDB
    D Fischer, J Pa_, L Rychlewski - Bioinformatics, 2004 - Oxford Univ Press
     
    9. Structural characterization of an ironsulfur cluster assembly protein IscU in a zinc_bound form
    J Liu, N Oganesyan, DH Shin, J Jancarik - Proteins: Structure, , 2006 - Wiley Online Library
     
    10. Expression, crystallization and preliminary crystallographic analysis of SufE (XAC2355) from Xanthomonas axonopodis pv. citri
    CR Guzzo, LR Silva, LMP Galvo-Botton - Section F: Structural , 2006 - scripts.iucr.org
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch