.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qxf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold. Protein Sci. 13 1407-1416 2004
    Site NESGC
    PDB Id 1qxf Target Id GR2
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8890,2.20.25.100, 2.20.25.10, PF01667, 5682 Molecular Weight 6513.22 Da.
    Residues 58 Isoelectric Point 5.85
    Sequence mhsrfvkvkcpdceheqvifdhpstivkciicgrtvaeptggkgnikaeiieyvdqie
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1qxf
    1. Prediction of protein tertiary structure using PROFESY, a novel method based on fragment assembly and conformational space annealing
    J Lee, SY Kim, K Joo, I Kim, J Lee - : Structure, Function, and , 2004 - Wiley Online Library
     
    2. The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold
    C Herve du Penhoat, HS Atreya, Y Shen, G Liu - Protein , 2004 - Wiley Online Library
     
    3. Comparison of different torsion angle approaches for NMR structure determination
    B Bardiaux, TE Malliavin, M Nilges - Journal of biomolecular , 2006 - Springer
     
    4. Solution structure of human DESR1, a CSL zinc_binding protein
    F Wu, J Zhang, J Sun, H Huang, P Ji - Proteins: Structure, , 2008 - Wiley Online Library
     
    5. The 2.2- Structure of the HP0958 Protein from Helicobacter pylori Reveals a Kinked Anti-Parallel Coiled-Coil Hairpin Domain and a Highly Conserved Zn-Ribbon
    DL Caly, PW O'Toole, SA Moore - Journal of molecular biology, 2010 - Elsevier
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch