.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r57

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins. J.STRUCT.FUNCT.GENOM. 9 7-20 2008
    Site NESGC
    PDB Id 1r57 Target Id ZR31
    Related PDB Ids 2h5m 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9274,3.40.630.30, PF00583, 5845 Molecular Weight 10579.27 Da.
    Residues 94 Isoelectric Point 5.07
    Sequence msnleikqgenkfyigddenhalaeityrfvdnneinidhtgvsdelggqgvgkklvkavveharenhl kiiascsfakhmlekedsyqdvylg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r57
    1. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    2. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    3. Structure of Arabidopsis thaliana At1g77540 protein, a minimal acetyltransferase from the COG2388 family
    RC Tyler, E Bitto, CE Berndsen, CA Bingman - Biochemistry, 2006 - ACS Publications
     
    4. Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins
    JR Cort, TA Ramelot, D Murray, TB Acton - Journal of structural and , 2008 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch