.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r9p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the iron-sulfur cluster assembly protein U (IscU) with zinc bound at the active site. J.Mol.Biol. 344 567-583 2004
    Site NESGC
    PDB Id 1r9p Target Id IR24
    Related PDB Ids 1q48 
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8936,3397, 3.90.1010.10, 5842, PF01592 Molecular Weight 13398.46 Da.
    Residues 126 Isoelectric Point 4.99
    Sequence maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfktygcgsaias sslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiadykakqg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1r9p
    1. Solution NMR structure of the iron-sulfur cluster assembly protein U (IscU) with zinc bound at the active site
    TA Ramelot, JR Cort, S Goldsmith-Fischman - Journal of molecular , 2004 - Elsevier
     
    2. Fe-S cluster assembly pathways in bacteria
    C Ayala-Castro, A Saini, FW Outten - Microbiology and molecular , 2008 - Am Soc Microbiol
     
    3. The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes
    S Goldsmith-Fischman, A Kuzin, WC Edstrom - Journal of molecular , 2004 - Elsevier
     
    4. The asymmetric trimeric architecture of [2Fe-2S] IscU: Implications for its scaffolding during iron-sulfur cluster biosynthesis
    Y Shimomura, K Wada, K Fukuyama - Journal of molecular , 2008 - Elsevier
     
    5. High_quality homology models derived from NMR and X_ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family
    G Liu, Z Li, Y Chiang, T Acton, GT Montelione - Protein , 2005 - Wiley Online Library
     
    6. Structure and Dynamics of the Iron_ Sulfur Cluster Assembly Scaffold Protein IscU and Its Interaction with the Cochaperone HscB
    JH Kim, AK Fu_ze_ry, M Tonelli, DT Ta, WM Westler - Biochemistry, 2009 - ACS Publications
     
    7. Structural studies of the Enterococcus faecalis SufU [Fe-S] cluster protein
    GP Riboldi, H Verli, J Frazzon - BMC biochemistry, 2009 - biomedcentral.com
     
    8. Prediction of structures of zinc_binding proteins through explicit modeling of metal coordination geometry
    C Wang, R Vernon, O Lange, M Tyka - Protein , 2010 - Wiley Online Library
     
    9. Ironsulfur cluster biosynthesis: role of a semi-conserved histidine
    J Huang, JA Cowan - Chemical Communications, 2009 - pubs.rsc.org
     
    10. Structural characterization of an ironsulfur cluster assembly protein IscU in a zinc_bound form
    J Liu, N Oganesyan, DH Shin, J Jancarik - Proteins: Structure, , 2006 - Wiley Online Library
     
    11. Expression, crystallization and preliminary crystallographic analysis of SufE (XAC2355) from Xanthomonas axonopodis pv. citri
    CR Guzzo, LR Silva, LMP Galvo-Botton - Section F: Structural , 2006 - scripts.iucr.org
     
    12. Three-Dimensional Structure and Determinants of Stability of the Iron-Sulfur Cluster Scaffold Protein IscU from Escherichia coli
    JH Kim, M Tonelli, T Kim, JL Markley - Biochemistry, 2012 - ACS Publications
     
    13. Molecular chaperones and iron-sulfur cluster biogenesis in Saccharomyces cerevisiae
    AJ Andrew - 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch