.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rcu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF TM1055 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET VT76. TO BE PUBLISHED
    Site NESGC
    PDB Id 1rcu Target Id VT76
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9226,3.40.50.450, PF03641 Molecular Weight 18434.44 Da.
    Residues 171 Isoelectric Point 5.50
    Sequence mkkvvvvgysgpvnkspvselrdiclelgrtlakkgylvfnggrdgvmelvsqgvreaggtvvgilpde eagnpylsvavktgldfqmrsfvllrnadvvvsiggeigtaieilgayalgkpvillrgtggwtdrisq vlidgkyldnrriveihqawtveeavqiieqil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.236
    Matthews' coefficent 1.92 Rfactor 0.216
    Waters Solvent Content 35.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rcu
    1. Structural relationships among proteins with different global topologies and their implications for function annotation strategies
    D Petrey, M Fischer, B Honig - Proceedings of the National , 2009 - National Acad Sciences
     
    2. Combining specificity determining and conserved residues improves functional site prediction
    O Kalinina, M Gelfand, R Russell - BMC bioinformatics, 2009 - biomedcentral.com
     
    3. X_ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210
    WB Jeon, S Allard, CA Bingman, E Bitto - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8
    M Kukimoto_Niino, K Murayama - Protein , 2004 - Wiley Online Library
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch