.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rq6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of ribosomal protein S17E from Methanobacterium thermoautotrophicum: a structural homolog of the FF domain. Protein Sci. 17 583-588 2008
    Site NESGC
    PDB Id 1rq6 Target Id TT802
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9212,6028, PF00833, 1.10.60.20 Molecular Weight 7198.97 Da.
    Residues 62 Isoelectric Point 9.90
    Sequence mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisqqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rq6
    1. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    2. The solution structure of ribosomal protein S17E from Methanobacterium thermoautotrophicum: A structural homolog of the FF domain
    B Wu, A Yee, YJ Huang, TA Ramelot, JR Cort - Protein , 2008 - Wiley Online Library
     
    3. Limits of Constitutional Text and Structure Revisited, The
    A Stone - UNSWLJ, 2005 - HeinOnline
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch