.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rtw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.35 A structure of the TenA homolog from Pyrococcus furiosus supports an enzymatic function in thiamine metabolism. Acta Crystallogr.,Sect.D 61 589-598 2005
    Site NESGC
    PDB Id 1rtw Target Id PfR34
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9018,PF03070, 1.20.910.10 Molecular Weight 25422.77 Da.
    Residues 212 Isoelectric Point 5.18
    Sequence mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmakapddllpff aesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsflegftalyceekayyeawkw vrenlkerspyqefinhwssqefgeyvkriekilnslaekhgefekerarevfkevskfelifwdiayg gegnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.35 Rfree 0.281
    Matthews' coefficent 2.40 Rfactor 0.24
    Waters 234 Solvent Content 48.67

    Ligand Information
    Ligands MP5 ((4-AMINO-2-METHYLPYRIMIDIN-5-YL)METHYL) x 1;PO4 (PHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1rtw
    1. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    2. Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II
    V Angela, AL Haas, JH Park, TP Begley, SE Ealick - Biochemistry, 2005 - ACS Publications
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. The 2.35 A structure of the TenA homolog from Pyrococcus furiosus supports an enzymatic function in thiamine metabolism
    J Benach, WC Edstrom, I Lee, K Das - Section D: Biological , 2005 - scripts.iucr.org
     
    5. Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathwayevidence of a different substrate specificity
    N Barison, L Cendron, A Trento, A Angelini - FEBS , 2009 - Wiley Online Library
     
    6. Engineering aluminum binding affinity in an isolated EF-hand from troponin C: A computational site-directed mutagenesis study
    RE Bongini, SB Culver, KM Elkins - Journal of inorganic biochemistry, 2007 - Elsevier
     
    7. Structure of trifunctional THI20 from yeast
    JB French, TP Begley, SE Ealick - Acta Crystallographica Section D: , 2011 - scripts.iucr.org
     
    8. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    9. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch