.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.STRUCT.FUNCT.GENOM. 8 37-44 2007
    Site NESGC
    PDB Id 1rty Target Id SR128
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9063,PF01923, 1.20.1200.10 Molecular Weight 21489.06 Da.
    Residues 193 Isoelectric Point 5.37
    Sequence mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfd cggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvva lmkseeihetvlrylnrlsdyffagarvvnarsgigdveyersaivfrdrnsses
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.28
    Matthews' coefficent 2.35 Rfactor 0.224
    Waters 183 Solvent Content 47.66

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1rty
    1. Comparisons of NMR spectral quality and success in crystallization demonstrate that NMR and X-ray crystallography are complementary methods for small protein
    DA Snyder, Y Chen, NG Denissova - Journal of the , 2005 - ACS Publications
     
    2. Mass fractal dimension and the compactness of proteins
    MB Enright, DM Leitner - Physical Review E, 2005 - APS
     
    3. A periodic table of coiled-coil protein structures
    E Moutevelis, DN Woolfson - Journal of molecular biology, 2009 - Elsevier
     
    4. Functional annotation by identification of local surface similarities: a novel tool for structural genomics
    F Ferr, G Ausiello, A Zanzoni - BMC , 2005 - biomedcentral.com
     
    5. Structure of ATP-bound human ATP: cobalamin adenosyltransferase
    HL Schubert, CP Hill - Biochemistry, 2006 - ACS Publications
     
    6. Structural characterization of the active site of the PduO-type ATP: Co (I) rrinoid adenosyltransferase from Lactobacillus reuteri
    MS Maurice, PE Mera, MP Taranto, F Sesma - Journal of Biological , 2007 - ASBMB
     
    7. Structural Characterization of a Human-Type Corrinoid Adenosyltransferase Confirms That Coenzyme B12 Is Synthesized through a Four-Coordinate Intermediate
    M St. Maurice, P Mera, K Park, TC Brunold - Biochemistry, 2008 - ACS Publications
     
    8. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    9. Crystal structure of the hypothetical protein TA1238 from Thermoplasma acidophilum: a new type of helical super-bundle
    R Sanishvili, M Pennycooke, J Gu, X Xu - Journal of structural and , 2005 - Springer
     
    10. Side-chain rotamers in protein _-_ hairpins and a mechanism of their selection
    AM Kargatov, AV Efimov - Molecular Biology, 2007 - Springer
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch