.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rwu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural similarity of YbeD protein from Escherichia coli to allosteric regulatory domains. J.Bacteriol. 186 8083-8088 2004
    Site NESGC
    PDB Id 1rwu Target Id ET105
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8867,PF04359 Molecular Weight 9826.88 Da.
    Residues 87 Isoelectric Point 5.50
    Sequence mktklnellefptpftykvmgqalpelvdqvvevvqrhapgdytptvkpsskgnyhsvsitinathieq vetlyeelgkidivrmvl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rwu
    1. Structural similarity of YbeD protein from Escherichia coli to allosteric regulatory domains
    G Kozlov, D Elias, A Semesi, A Yee - Journal of , 2004 - Am Soc Microbiol
     
    2. Solution structure of hypothetical protein, HP0495 (Y495_HELPY) from Helicobacter pylori
    MD Seo, SJ Park, HJ Kim, BJ Lee - Proteins: Structure, Function , 2007 - Wiley Online Library
     
    3. Structural Analysis of Hypothetical Proteins from Helicobacter pylori: An Approach to Estimate Functions of Unknown or Hypothetical Proteins
    SJ Park, WS Son, BJ Lee - International Journal of Molecular Sciences, 2012 - mdpi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch