.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ryj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title AN NMR APPROACH TO STRUCTURAL PROTEOMICS. Proc.Natl.Acad.Sci.USA 99 1825-1830 2002
    Site NESGC
    PDB Id 1ryj Target Id TT526
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9208,PF02597, 5106, 3.10.20.30 Molecular Weight 7755.69 Da.
    Residues 70 Isoelectric Point 4.56
    Sequence mvigmkftvitddgkkilesgaprrikdvlgeleipietvvvkkngqivideeeifdgdiievirviygg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ryj
    1. Backbone solution structures of proteins using residual dipolar couplings: application to a novel structural genomics target
    H Valafar, KL Mayer, CM Bougault, PD LeBlond - Journal of structural and , 2005 - Springer
     
    2. Sequence specific resonance assignment via Multicanonical Monte Carlo search using an ABACUS approach
    A Lemak, CA Steren, CH Arrowsmith - Journal of biomolecular , 2008 - Springer
     
    3. A hierarchical grow-and-match algorithm for backbone resonance assignments given 3D structure
    F Xiong, C Bailey-Kellogg - . BIBE 2007. Proceedings of the 7th , 2007 - ieeexplore.ieee.org
     
    4. Automated error-tolerant macromolecular structure determination from multidimensional nuclear Overhauser enhancement spectra and chemical shift assignments:
    JJ Kuszewski, RA Thottungal, GM Clore - Journal of biomolecular , 2008 - Springer
     
    5. Towards fully automated structure-based NMR resonance assignment of 15N-labeled proteins from automatically picked peaks
    R Jang, X Gao, M Li - Journal of Computational Biology, 2011 - online.liebertpub.com
     
    6. Fuzzy oil drop model applied to individual small proteins built of 70 amino acids
    K Prymula, K Sa_apa, I Roterman - Journal of molecular modeling, 2010 - Springer
     
    7. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    8. Fold and Function of the InlB B-repeat
    M Ebbes, WM Bleymller, M Cernescu, R Nlker - Journal of Biological , 2011 - ASBMB
     
    9. Quantum Proteomics
    F Pichierri - Arxiv preprint arXiv:1107.5853, 2011 - arxiv.org
     
    10. Towards automated structure-based NMR assignment
    R Jang, X Gao, M Li - 2009 - Citeseer
     
    11. Towards automated structure-based NMR resonance assignment
    R Jang, X Gao, M Li - Research in Computational Molecular Biology, 2010 - Springer
     
    12. Integer Programming Model for Automated Structure-based NMR Assignment
    R Jang, X Gao, M Li - 2009 - cs.uwaterloo.ca
     
    13. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    14. Fast and Robust Mathematical Modeling of NMR Assignment Problems
    R Jang - 2012 - uwspace.uwaterloo.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch