.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ryk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An NMR approach to structural proteomics. Proteins 47 572-574 2002
    Site NESGC
    PDB Id 1ryk Target Id ET93
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8876,1.10.1470.10, 5105, PF05532 Molecular Weight 8324.92 Da.
    Residues 69 Isoelectric Point 5.44
    Sequence mnkdeaggnwkqfkgkvkeqwgkltdddmtiiegkrdqlvgkiqerygyqkdqaekevvdwetrneyrw
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ryk
    1. Docking studies on isoform-specific inhibition of phosphoinositide-3-kinases
    DA Sabbah, JL Vennerstrom - Journal of chemical , 2010 - ACS Publications
     
    2. Protein folding through kinetic discrimination
    S Linse, B Linse - Journal of the American Chemical Society, 2007 - ACS Publications
     
    3. Fuzzy oil drop model applied to individual small proteins built of 70 amino acids
    K Prymula, K Sa_apa, I Roterman - Journal of molecular modeling, 2010 - Springer
     
    4. Recognizing protein folds by cluster distance geometry
    GM Crippen - Proteins: Structure, Function, and Bioinformatics, 2005 - Wiley Online Library
     
    5. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    6. Application of long_range order to predict unfolding rates of two_state proteins
    B Harihar, S Selvaraj - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     
    7. Topological quantities determining the folding/unfolding rate of two-state folding proteins
    J Jung, AJ Buglass, EK Lee - Journal of solution chemistry, 2010 - Springer
     
    8. Predicting protein folding rate from amino acid sequence
    J GUO, N RAO - J Bioinform Comput Biol, 2011 - worldscinet.com
     
    9. IOPscience-Local and non-local native topologies reveal the underlying folding landscape of proteins
    T Zou, SB Ozkan - Physical Biology, 2011 - iopscience.iop.org
     
    10. Role of Long-Range Contacts and Structural Classification in Understanding the Free Energy of Unfolding of Two-State Proteins
    B Hariha, S Selvaraj - Current Bioinformatics, 2012 - ingentaconnect.com
     
    11. Integrated prediction of protein folding and unfolding rates from only size and structural class
    D De Sancho, V Muoz - Phys. Chem. Chem. Phys., 2011 - xlink.rsc.org
     
    12. Closed loop folding units from structural alignments: Experimental foldons revisited
    SV Chintapalli, BK Yew, CJR Illingworth - Journal of , 2010 - Wiley Online Library
     
    13. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch