.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s04

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13. To be Published
    Site NESGC
    PDB Id 1s04 Target Id PfR13
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9015,3.10.480.10, PF04266, 3.10.290.10, 6045 Molecular Weight 13155.68 Da.
    Residues 110 Isoelectric Point 6.43
    Sequence mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsfremlekegl envlpgvksieegiqvyrrfydeekekkygvvaieiepley
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1s04
    1. A coarse_grained protein force field for folding and structure prediction
    J Maupetit, P Tuffery - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. Protein structure prediction: The next generation
    MC Prentiss, C Hardin, MP Eastwood - Journal of Chemical , 2006 - ACS Publications
     
    4. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    5. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of an ASCH domain-containing protein from Zymomonas mobilis ZM4
    SY Park, JH Park, JS Kim - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     
    8. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    9. Soft energy function and generic evolutionary method for discriminating native from nonnative protein conformations
    Y Chiu, J Hwang, J Yang - Journal of computational chemistry, 2008 - Wiley Online Library
     
    10. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    11. METHOD FOR USING REF PROTEIN AS A TARGETED RECA-DEPENDENT NUCLEASE
    MM Cox, MC Eichhern-Gruenig - US Patent App. 13/ , 2011 - Google Patents
     
    12. Protein Structure Prediction Using a Profile-Profile Comparison Method: FORTE
    _____ - ____, 2006 - J-STAGE
     
    13. Experiment planning for protein structure elucidation and site-directed protein recombination
    X Ye - 2007 - cs.dartmouth.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch