.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sbk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structure of YDII_ECOLI Northeast Structural Genomics Consortium Target ER29. To be Published
    Site NESGC
    PDB Id 1sbk Target Id ER29
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8839,PF03061, 3.10.129.10 Molecular Weight 14944.47 Da.
    Residues 136 Isoelectric Point 6.96
    Sequence miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvvlaesigsva gylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifdekgrlccssrlttail
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.272
    Matthews' coefficent 1.98 Rfactor 0.223
    Waters 425 Solvent Content 37.82

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1sbk
    1. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch