.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sgo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of the human C14orf129 gene product, HSPC210. Northeast Structural Genomics target HR969. To be Published
    Site NESGC
    PDB Id 1sgo Target Id HR969
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8925,PF05303, 6052 Molecular Weight 15587.54 Da.
    Residues 139 Isoelectric Point 4.36
    Sequence metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlsavnnmfvskslrcaddvayinve tkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayreafgnallqrlealkrdgqs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sgo
    1. Contact replacement for NMR resonance assignment
    F Xiong, G Pandurangan, C Bailey-Kellogg - Bioinformatics, 2008 - Oxford Univ Press
     
    2. Towards fully automated structure-based NMR resonance assignment of 15N-labeled proteins from automatically picked peaks
    R Jang, X Gao, M Li - Journal of Computational Biology, 2011 - online.liebertpub.com
     
    3. Prediction of the binding mode between GSK3_ and a peptide derived from GSKIP using molecular dynamics simulation
    XN Tang, CW Lo, YC Chuang, CT Chen, YC Sun - , 2011 - Wiley Online Library
     
    4. Involvement of the residues of GSKIP, AxinGID, and FRATtide in their binding with GSK3_ to unravel a novel C-terminal scaffold-binding region
    SL Howng, CC Hwang, CY Hsu, MY Hsu - Molecular and cellular , 2010 - Springer
     
    5. Towards automated structure-based NMR assignment
    R Jang, X Gao, M Li - 2009 - Citeseer
     
    6. Combining automated peak tracking in SAR by NMR with structure-based backbone assignment from 15N-NOESY
    R Jang, X Gao, M Li - BMC bioinformatics, 2012 - biomedcentral.com
     
    7. Towards automated structure-based NMR resonance assignment
    R Jang, X Gao, M Li - Research in Computational Molecular Biology, 2010 - Springer
     
    8. Integer Programming Model for Automated Structure-based NMR Assignment
    R Jang, X Gao, M Li - 2009 - cs.uwaterloo.ca
     
    9. Combining ambiguous chemical shift mapping with structure-based backbone and NOE assignment from 15 N-NOESY
    R Jang, X Gao, M Li - Proceedings of the 2nd ACM Conference on , 2011 - dl.acm.org
     
    10. Fast and Robust Mathematical Modeling of NMR Assignment Problems
    R Jang - 2012 - uwspace.uwaterloo.ca
     
    11. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch