.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sou

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of Aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: Northeast Structural Genomics Consortium Target QR46. To be Published
    Site NESGC
    PDB Id 1sou Target Id QR46
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9040,PF01812, 3.40.50.10420, 6199 Molecular Weight 21251.76 Da.
    Residues 186 Isoelectric Point 9.35
    Sequence mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltplfpevlkeke lilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgvafdlegyrlgfgkgyydr llkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrrlrdgrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sou
    1. Structure of mammalian cytochrome P450 2B4 complexed with 4-(4-chlorophenyl) imidazole at 1.9- resolution
    EE Scott, MA White, YA He, EF Johnson - Journal of Biological , 2004 - ASBMB
     
    2. Structural and functional characterization of a 5, 10_methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087)
    S Chen, AF Yakunin, M Proudfoot - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. Diversification of catalytic activities and ligand interactions in the protein fold shared by the sugar isomerases, eIF2B, DeoR transcription factors, acyl-CoA transferases
    V Anantharaman, L Aravind - Journal of molecular biology, 2006 - Elsevier
     
    4. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    5. BCL:: ContactLow Confidence Fold Recognition Hits Boost Protein Contact Prediction and De Novo Structure Determination
    M Karaka_, N Woetzel, J Meiler - Journal of Computational , 2010 - online.liebertpub.com
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch