.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Chorismate Synthase from Campylobacter jejuni, Northeast Structural Genomics Target BR19. To be Published
    Site NESGC
    PDB Id 1sq1 Target Id BR19
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS8743,PF01264 Molecular Weight 39249.62 Da.
    Residues 362 Isoelectric Point 8.38
    Sequence mntfgtrlkftsfgeshgvavgciidgmpagvkfdeeflqneldkrkggskfatprkesdkaqvlsgvf egyttghpiaivvfnenahskdydnlkdlfrpahadftyfykygirdhrgggrssaresvarvaggava amllrefdicvqsgvfgvgtfvsnlkeeefdfefakkseifcldpklesdfkneilnarnskdsvgaav ftkvsgmliglgevlydkldsklahalmginavkaveigeginaskmrgscnndalkdgkflsnhsggi lggisngenlilktyfkptpsifakqesidkfgnnlkfelkgrhdpcvgvrgsvvasamvrlvladcll lnasanlnnlknayglk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.279
    Matthews' coefficent 3.81 Rfactor 0.224
    Waters 7 Solvent Content 67.43

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1sq1
    1. Chorismate synthase: an attractive target for drug development against orphan diseases
    B Dias, V Marcio, F Ely, MS Palma - Current drug , 2007 - ingentaconnect.com
     
    2. Homology modeling and molecular dynamics study of chorismate synthase from Shigella flexneri
    H Zhou, N Singh, KS Kim - Journal of Molecular Graphics and Modelling, 2006 - Elsevier
     
    3. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     
    4. Understanding the Structure, Activity and Inhibition of Chorismate Synthase from Mycobacterium tuberculosis
    HA Arcuri, MS Palma - Current Medicinal Chemistry, 2011 - ingentaconnect.com
     
    5. Modelagem molecular e estudos de docking da enzima corismato sintase de Mycobacterium tuberculosis
    CL Fernandes - 2006 - lume.ufrgs.br
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch