.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sqh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF DROSOPHILA MALONOGASTER PROTEIN Q9VR51 NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET FR87. To be Published
    Site NESGC
    PDB Id 1sqh Target Id FR87
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS8886,3.40.630.30, PF08445 Molecular Weight 34833.91 Da.
    Residues 304 Isoelectric Point 7.01
    Sequence mssdkngdilrplsdsevdelldlykvkfgirnfhylllynqrkwdrqlseaqiprndlnhislrkqfy thrrgnfrtwgtyvslhrdivqsvsffswqpdgaaelwecleqtqliewtqgalltnvdlgfcnrvkel avsrgvtaiqprqcfgmvlshedafcakvpdlpsefeirrlraedaamvhdswpnkgegsltylqalvr fnkslgicrsdtgeliawifqndfsglgmlqvlpkaerrglggllaaamsreiargeeitltawivatn wrseallkrigyqkdlvnewiklvpnss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.262
    Matthews' coefficent 2.56 Rfactor 0.224
    Waters 152 Solvent Content 50.18

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sqh
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    3. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    4. Enzymatic Characterization and Elucidation of the Catalytic Mechanism of a Recombinant Bovine Glycine N-Acyltransferase
    CPS Badenhorst, M Jooste, AA Van Dijk - Drug Metabolism and Disposition, 2012 - ASPET
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch