.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sqs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.STRUCT.FUNCT.GENOM 8 37-44 2007
    Site NESGC
    PDB Id 1sqs Target Id SpR27
    Related PDB Ids 2oys 
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS9158,PF03358, 3.40.50.360, PF02525 Molecular Weight 27146.14 Da.
    Residues 234 Isoelectric Point 5.18
    Sequence mnkifiyagvrnhnsktleytkrlssiissrnnvdisfrtpfnseleisnsdseelfkkgidrqsnadd ggvikkellesdiiiisspvylqnvsvdtknfieriggwshlfrlagkfvvtldvaesngsdnvseylr difsymggqilhqvsitnslkdiaeaqlmeatykiedvlegkikykttdyqerayqtlklilenydseh fekmywekkrlfeansleewyyvenik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.22
    Matthews' coefficent 2.26 Rfactor 0.2
    Waters 536 Solvent Content 45.55

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1sqs
    1. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    3. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch