.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t0v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure and dynamics of the engineered fluorescein-binding lipocalin FluA reveal rigidification of beta-barrel and variable loops upon enthalpy-driven ligand binding. Biochemistry 48 7411-7419 2009
    Site NESGC
    PDB Id 1t0v Target Id OR17
    Molecular Characteristics
    Source Other
    Alias Ids TPS31843,PF08212, PF00061, 2.40.128.20 Molecular Weight 21000.46 Da.
    Residues 184 Isoelectric Point 7.19
    Sequence dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsrydvihgkeyfm egtaypvgdskigkiyhsrtvggytkktvfnvlstdnknyiigyscrydedkkghwdhvwvlsrsmvlt geaktavenyligspvvdsqklvysdfseaackvnnsnwshpqfek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t0v
    1. A new generation of protein display scaffolds for molecular recognition
    RJ Hosse, A Rothe, BE Power - Protein science, 2006 - Wiley Online Library
     
    2. Protein scaffold-based molecular probes for cancer molecular imaging
    Z Miao, J Levi, Z Cheng - Amino acids, 2011 - Springer
     
    3. NMR Structure and Dynamics of the Engineered Fluorescein-Binding Lipocalin FluA Reveal Rigidification of _-Barrel and Variable Loops upon Enthalpy-Driven
    JL Mills, G Liu, A Skerra, T Szyperski - Biochemistry, 2009 - ACS Publications
     
    4. Steered molecular dynamics simulations of ligandreceptor interaction in lipocalins
    J Kalikka, J Akola - European Biophysics Journal, 2011 - Springer
     
    5. Application of PI-deconvolution to the screening of protein ligand combinatorial libraries using the yeast-two-hybrid assay
    A Aparicio - 2008 - library.usask.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch