.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the 18 kDa protein CC1736 from Caulobacter crescentus identifies a member of the START domain superfamily and suggests residues mediating substrate specificity. Proteins 58 747-750 2005
    Site NESGC
    PDB Id 1t17 Target Id CcR19
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS8789,PF10604, 3.30.530.20, 6120, PF03364 Molecular Weight 16663.26 Da.
    Residues 148 Isoelectric Point 8.82
    Sequence mhrhvvtkvlpytpdqlfelvgdvdaypkfvpwitgmrtwngrvdgavstvdaeaqvgfsflrekfatr vrrdkdarsidvsllygpfkrlnngwrfmpegdatrvefviefafksalldamlaanvdraagkliacf earaqqlhga
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t17
    1. Protein backbone chemical shifts predicted from searching a database for torsion angle and sequence homology
    Y Shen, A Bax - Journal of biomolecular NMR, 2007 - Springer
     
    2. The Bet v 1 fold: an ancient, versatile scaffold for binding of large, hydrophobic ligands
    C Radauer, P Lackner - BMC evolutionary biology, 2008 - biomedcentral.com
     
    3. Structural insight into the self-sacrifice mechanism of enediyne resistance
    S Singh, MH Hager, C Zhang, BR Griffith, MS Lee - 2006 - ACS Publications
     
    4. NMR structure of the 18 kDa protein CC1736 from Caulobacter crescentus identifies a member of the START domain superfamily and suggests residues mediating
    Y Shen, S Goldsmith_Fischman - Proteins: Structure, , 2005 - Wiley Online Library
     
    5. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     
    6. Site-directed mutagenesis and structural modeling of Coq10p indicate the presence of a tunnel for coenzyme Q6 binding
    C Busso, L Bleicher, JR Ferreira-Jnior, MH Barros - FEBS letters, 2010 - Elsevier
     
    7. Structure of a conserved hypothetical protein, TTHA0849 from Thermus thermophilus HB8, at 2.4 A resolution: a putative member of the StAR-related lipid-transfer (
    M Nakabayashi, N Shibata, H Komori - Section F: Structural , 2005 - scripts.iucr.org
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch