.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Northeast Structural Genomics Consortium Target HR2118:A Human Homolog of Saccharomyces cerevisiae Nip7p. To be Published
    Site NESGC
    PDB Id 1t5y Target Id HR2118
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8912,PF03657, 2.30.130.10 Molecular Weight 20461.59 Da.
    Residues 180 Isoelectric Point 8.66
    Sequence mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisgdklvslgtc fgkftkthkfrlhvtaldylapyakykvwikpgaeqsflygnhvlksglgritentsqyqgvvvysmad iplgfgvaakstqdcrkvdpmaivvfhqadigeyvrheetlt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.294
    Matthews' coefficent 2.57 Rfactor 0.213
    Waters 49 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t5y
    1. Evaluating protein structures determined by structural genomics consortia
    A Bhattacharya, R Tejero - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    3. Crystal structure of a Cbf5-Nop10-Gar1 complex and implications in RNA-guided pseudouridylation and dyskeratosis congenita
    R Rashid, B Liang, DL Baker, OA Youssef, Y He - Molecular cell, 2006 - Elsevier
     
    4. The Structure of the RNA m 5 C Methyltransferase YebU from Escherichia coli Reveals a C-terminal RNA-recruiting PUA Domain
    BM Hallberg, UB Ericsson, KA Johnson - Journal of molecular , 2006 - Elsevier
     
    5. Crystal structure of the Escherichia coli 23S rRNA: m5C methyltransferase RlmI (YccW) reveals evolutionary links between RNA modification enzymes
    S Sunita, KL Tkaczuk, E Purta, JM Kasprzak - Journal of molecular , 2008 - Elsevier
     
    6. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    7. The crystal structure of a novel SAM_dependent methyltransferase PH1915 from Pyrococcus horikoshii
    W Sun, X Xu, M Pavlova, AM Edwards - Protein , 2005 - Wiley Online Library
     
    8. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    9. Structural and Biochemical Characterization of RNA-Guided Modification Enzymes
    R Rashid - 2005 - diginole.lib.fsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch