.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t82

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative thioesterase from Shewanella oneidensis, Northeast Structural Genomics Target SoR51. TO BE PUBLISHED
    Site NESGC
    PDB Id 1t82 Target Id SoR51
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9150,3.10.129.10, PF09500 Molecular Weight 16264.09 Da.
    Residues 145 Isoelectric Point 6.39
    Sequence mdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimtltgwgmvwl qqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakvklevqlfcdgklcaqfdgl yvsvpkm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.222
    Matthews' coefficent 2.10 Rfactor 0.194
    Waters 434 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t82
    1. Rv0216, a conserved hypothetical protein from Mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdog fold
    A Castell, P Johansson, T Unge, TA Jones - Protein , 2005 - Wiley Online Library
     
    2. Detection of Functionally Important Regions in
    G Nimrod, M Schushan, DM Steinberg, N Ben-Tal - Structure, 2008 - Elsevier
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch