.
The Open Protein Structure Annotation Network
PDB Keyword
.

1te7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title G-Matrix Fourier Transform NOESY-Based Protocol for High-Quality Protein Structure Determination. J.Am.Chem.Soc. 127 9085-9099 2005
    Site NESGC
    PDB Id 1te7 Target Id ET99
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8879,PF04266, 6207 Molecular Weight 11904.81 Da.
    Residues 103 Isoelectric Point 4.68
    Sequence mqpnditffqrfqddilagrktitirdeseshfktgdvlrvgrfeddgyfctievtatstvtldtltek haeqenmtltelkkviadiypgqtqfyviefkcl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1te7
    1. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    2. A coarse_grained protein force field for folding and structure prediction
    J Maupetit, P Tuffery - : Structure, Function, and , 2007 - Wiley Online Library
     
    3. G-matrix Fourier transform NOESY-based protocol for high-quality protein structure determination
    Y Shen, HS Atreya, G Liu - Journal of the American , 2005 - ACS Publications
     
    4. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    5. Protein structure prediction: The next generation
    MC Prentiss, C Hardin, MP Eastwood - Journal of Chemical , 2006 - ACS Publications
     
    6. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    7. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    8. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    9. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    10. G-matrix Fourier transformation (GFT) nuclear magnetic resonance (NMR) experiments for resonance assignment and structure determination of organic molecules
    TA Szyperski, HS Atreya - US Patent 7,920,972, 2011 - Google Patents
     
    11. Soft energy function and generic evolutionary method for discriminating native from nonnative protein conformations
    Y Chiu, J Hwang, J Yang - Journal of computational chemistry, 2008 - Wiley Online Library
     
    12. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    13. Protein Structure Prediction Using a Profile-Profile Comparison Method: FORTE
    _____ - ____, 2006 - J-STAGE
     
    14. Experiment planning for protein structure elucidation and site-directed protein recombination
    X Ye - 2007 - cs.dartmouth.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch