.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tiq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase. J.Biol.Chem. 280 40328-40336 2005
    Site NESGC
    PDB Id 1tiq Target Id SR64
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9116,3.40.630.30, PF00583, PF08445 Molecular Weight 20013.75 Da.
    Residues 172 Isoelectric Point 5.19
    Sequence msvkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqfffiyfdhe iagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieialernkkniwlgvweknena iafykkmgfvqtgahsfymgdeeqtdlimaktli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 2.23 Rfactor 0.206
    Waters 272 Solvent Content 44.90

    Ligand Information
    Ligands COA-COA (COENZYME) x 1;DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 2;SO4 (SULFATE) x 1;COA (COENZYME) x 1
    Metals

    Jmol

     
    Google Scholar output for 1tiq
    1. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    3. Crystal structure of TDP-fucosamine acetyltransferase (WecD) from Escherichia coli, an enzyme required for enterobacterial common antigen synthesis
    MN Hung, E Rangarajan, C Munger - Journal of , 2006 - Am Soc Microbiol
     
    4. Eukaryotic domain of unknown function DUF738 belongs to Gcn5-related N-acetyltransferase superfamily
    K Steczkiewicz, L Kinch, NV Grishin - CELL CYCLE- , 2006 - orphanresearch.org
     
    5. Comparative protein modeling
    EX Esposito, D Tobi, JD Madura - Reviews in computational , 2006 - Wiley Online Library
     
    6. Structure of Arabidopsis thaliana At1g77540 protein, a minimal acetyltransferase from the COG2388 family
    RC Tyler, E Bitto, CE Berndsen, CA Bingman - Biochemistry, 2006 - ACS Publications
     
    7. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    8. Crystal structure of the novel PaiA N_acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme
    EV Filippova, L Shuvalova, G Minasov - Proteins: Structure, , 2011 - Wiley Online Library
     
    9. PARAMECIUM BURSARIA CHLORELLA VIRUS 1 ENCODES A POLYAMINE ACETYLTRANSFERASE
    Z Charlop-Powers, J Jakoncic, JR Gurnon - Journal of Biological , 2012 - ASBMB
     
    10. Evolution of insect arylalkylamine N-acetyltransferases: Structural evidence from the yellow fever mosquito, Aedes aegypti
    Q Han, H Robinson, H Ding - Proceedings of the , 2012 - National Acad Sciences
     
    11. Solution structure of Apo_YjaB from Escherichia coli
    J Lu, X Wang, B Xia, C Jin - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     
    12. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    13. Comparative Protein Modeling
    JD Maduraz - Reviews in Computational Chemistry, 2006 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch