.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tiy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF GUANINE DEAMINASE FROM BACILLUS SUBTILIS NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SR160. To be published
    Site NESGC
    PDB Id 1tiy Target Id SR160
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9068,3.40.140.10, PF00383 Molecular Weight 17155.49 Da.
    Residues 156 Isoelectric Point 5.16
    Sequence mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtairkackvlgay qlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiykeidkpaeertipfyqvtlt ehlspfqawrnfankkey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.273
    Matthews' coefficent 2.46 Rfactor 0.222
    Waters 64 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1tiy
    1. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     
    2. Crystal structure of an ADP_ribosylated protein with a cytidine deaminase_like fold, but unknown function (TM1506), from Thermotoga maritima at 2.70 resolution
    Q Xu, P Kozbial, D McMullan - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch