.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tm0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.STRUCT.FUNCT.GENOM. 8 37-44 2007
    Site NESGC
    PDB Id 1tm0 Target Id LR31
    Molecular Characteristics
    Source Brucella melitensis
    Alias Ids TPS8943,PF05544, 3.10.310.10 Molecular Weight 36972.42 Da.
    Residues 342 Isoelectric Point 5.89
    Sequence mrstkvihivgchaegevgdvivggvapppgetvweqsrfiandetlrnfvlnkprggvfrhvnllvpp kdpraqmgfiimepadtppmsgsnsicvstvlldsgiiamqepvthmvleapggiieveaecrngkaer isvrnvpsfadrldapldvtglgtimvdtayggdsfvivdaaqigmkiepgqarelaeigvkitkaane qlgfrhperdwrhisfcqitepvtregdvltgvntvairpakfdrsptgtgcsarmavlhakgqmkage rfigksvlgtefhcrldkvlelggkpaispiisgrawvtgtsqlmldpsdpfphgyrlsdtwprde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.312
    Matthews' coefficent 2.25 Rfactor 0.236
    Waters 34 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tm0
    1. Crystal structure, catalytic mechanism, and mitogenic properties of Trypanosoma cruzi proline racemase
    A Buschiazzo, M Goytia, F Schaeffer - Proceedings of the , 2006 - National Acad Sciences
     
    2. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    3. The three_dimensional crystal structure of the PrpF protein of Shewanella oneidensis complexed with trans_aconitate: Insights into its biological function
    GS Garvey, CJ Rocco, JC Escalante_Semerena - Protein , 2007 - Wiley Online Library
     
    4. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     
    5. Structural and functional studies of Secondary Metabolite AcylTransferase superfamily members from the trichothecene mycotoxin biosynthetic pathway
    GS Garvey - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch