.
The Open Protein Structure Annotation Network
PDB Keyword
.

1to0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Northeast Structural Genomics target protein sr145 from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 1to0 Target Id SR145
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9066,PF02590, 3.40.1280.10 Molecular Weight 18072.10 Da.
    Residues 159 Isoelectric Point 8.92
    Sequence mninivtigklkekylkqgieeytkrlsayakidiielpdekapenlsdqdmkiikdkegdrilskisp dahvialaiegkmktseeladtidklatygkskvtfviggslglsdtvmkradeklsfskmtfphqlmr lilveqiyrafrinrgepyhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.29
    Matthews' coefficent 2.40 Rfactor 0.237
    Waters 182 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1to0
    1. Protein knots and fold complexity: Some new twists
    WR Taylor - Computational biology and chemistry, 2007 - Elsevier
     
    2. A comparison of the folding of two knotted proteins: YbeA and YibK
    AL Mallam, SE Jackson - Journal of molecular biology, 2007 - Elsevier
     
    3. PDB
    M Von Grotthuss, D Plewczynski, K Ginalski - BMC , 2006 - biomedcentral.com
     
    4. Rapid knot detection and application to protein structure prediction
    F Khatib, MT Weirauch, CA Rohl - Bioinformatics, 2006 - Oxford Univ Press
     
    5. 3D-Fun: predicting enzyme function from structure
    M Von Grotthuss, D Plewczynski, G Vriend - Nucleic Acids , 2008 - Oxford Univ Press
     
    6. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    7. Spectral markers for knotted core of proteins
    P Lissy Anto, AS Nair - CIB'2009, 2009 - cls.zju.edu.cn
     
    8. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     
    9. The Conformational Relationship between Knotted Proteins and Corresponding mRNA Templates
    RH Hung - 2007 - etdncku.lib.ncku.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch