.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ttz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Northeast Structural Genomics target protein XcR50 from X. campestris. To be Published
    Site NESGC
    PDB Id 1ttz Target Id XcR50
    Related PDB Ids 1xpv 
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9256,PF05768, 3.40.30.10, 6363 Molecular Weight 8703.32 Da.
    Residues 78 Isoelectric Point 4.51
    Sequence maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldwpfdaprlr awldaapha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.11 Rfree 0.212
    Matthews' coefficent 2.18 Rfactor 0.189
    Waters 109 Solvent Content 43.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ttz
    1. TALOS+: a hybrid method for predicting protein backbone torsion angles from NMR chemical shifts
    Y Shen, F Delaglio, G Cornilescu, A Bax - Journal of biomolecular NMR, 2009 - Springer
     
    2. Prediction of Xaa-Pro peptide bond conformation from sequence and chemical shifts
    Y Shen, A Bax - Journal of biomolecular NMR, 2010 - Springer
     
    3. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    4. Automated streak-seeding with micromachined silicon tools
    A Georgiev, S Vorobiev, W Edstrom, T Song - Section D: Biological , 2006 - scripts.iucr.org
     
    5. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    6. Limits of Constitutional Text and Structure Revisited, The
    A Stone - UNSWLJ, 2005 - HeinOnline
     
    7. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    8. Streak Seeding Automation Using Silicon Tools
    A Georgiev, S Vorobiev, W Edstrom, T Song - 2006 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch