.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tvg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study. Proteins 75 147-167 2009
    Site NESGC
    PDB Id 1tvg Target Id HR1958
    Related PDB Ids 1xpw 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8907,6344, 2.60.120.260, PF00754 Molecular Weight 16296.48 Da.
    Residues 144 Isoelectric Point 4.93
    Sequence mrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlviqsyfv qtlkiekstskepvdfeqwiekdlvhtegqlqneeivahdgsatylrfiivsafdhfasvhsvsaegtv vsnlss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.244
    Matthews' coefficent 2.00 Rfactor 0.215
    Waters 116 Solvent Content 39.00

    Ligand Information
    Ligands
    Metals SM (SAMARIUM) x 1;CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1tvg
    1. CS23D: a web server for rapid protein structure generation using NMR chemical shifts and sequence data
    DS Wishart, D Arndt, M Berjanskii, P Tang - Nucleic acids , 2008 - Oxford Univ Press
     
    2. Can molecular dynamics simulations provide high_resolution refinement of protein structure?
    J Chen, CL Brooks III - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    3. Comparative modeling in CASP6 using consensus approach to template selection, sequence_structure alignment, and structure assessment
    _ Venclovas, M Margelevi_ius - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    4. Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study
    TA Ramelot, S Raman, AP Kuzin, R Xiao - Proteins: Structure, , 2009 - Wiley Online Library
     
    5. Refining homology models by combining replica_exchange molecular dynamics and statistical potentials
    J Zhu, H Fan, X Periole, B Honig - : Structure, Function, and , 2008 - Wiley Online Library
     
    6. Crystal structure of the intraflagellar transport complex 25/27
    S Bhogaraju, M Taschner, M Morawetz, C Basquin - The EMBO , 2011 - nature.com
     
    7. Computational modeling of laminin N_terminal domains using sparse distance constraints from disulfide bonds and chemical cross_linking
    S Kalkhof, S Haehn, M Paulsson - Proteins: Structure, , 2010 - Wiley Online Library
     
    8. Structural basis for cell surface patterning through NetrinGNGL interactions
    E Seiradake, CH Coles, PV Perestenko, K Harlos - The EMBO , 2011 - nature.com
     
    9. Antibodies as a model system for comparative model refinement
    BD Sellers, JP Nilmeier - : Structure, Function, and , 2010 - Wiley Online Library
     
    10. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    11. Structural analysis of a putative family 32 carbohydrate-binding module from the Streptococcus pneumoniae enzyme EndoD
    DW Abbott, A Boraston - Acta Crystallographica Section F: Structural , 2011 - scripts.iucr.org
     
    12. Protein loop prediction by fragment assembly
    Z Liu - Masters Abstracts International, 2007 - el.trc.gov.om
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch