.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tz9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Mannonate Dehydratase from Enterococcus faecalis, Northeast Structural Genomics Target EfR41. To be Published
    Site NESGC
    PDB Id 1tz9 Target Id EfR41
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8881,PF01261, 3.20.20.150, PF03786 Molecular Weight 40279.88 Da.
    Residues 357 Isoelectric Point 5.29
    Sequence mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqeglallgiesvai hdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlayenedgslsllfdqavvenm qpedmyqlihsqskgfrlpgweeerlqqfqelkamyagvteedlvenlryflervipvceeenikmgih pddppweifglpritknladlkrilslvdspangitfctgslgadptndlptmireighrinfvhfrnv kylgehrfeetahpsvagsldmaelmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqg lyeatkakqnrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.292
    Matthews' coefficent 2.16 Rfactor 0.221
    Waters 33 Solvent Content 43.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tz9
    1. Comparative modeling in CASP6 using consensus approach to template selection, sequence_structure alignment, and structure assessment
    _ Venclovas, M Margelevi_ius - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. Fast and accurate algorithms for protein side-chain packing
    J Xu, B Berger - Journal of the ACM (JACM), 2006 - dl.acm.org
     
    4. Crystal structures of Streptococcus suis mannonate dehydratase (ManD) and its complex with substrate: genetic and biochemical evidence for a catalytic mechanism
    Q Zhang, F Gao, H Peng, H Cheng, Y Liu - Journal of , 2009 - Am Soc Microbiol
     
    5. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Crystal Structure of SCO6571 from Streptomyces coelicolor A3 (2)
    P Begum, N Sakai, T Hayashi, YG Gao - Protein and peptide , 2008 - ingentaconnect.com
     
    8. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     
    9. Structural insights into decreased enzymatic activity induced by an insert sequence in mannonate dehydratase from Gram negative bacterium
    X Qiu, Y Tao, Y Zhu, Y Yuan, Y Zhang, H Liu - Journal of Structural , 2012 - Elsevier
     
    10. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    11. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch