.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tza

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Northeast Structural Genomics Consortium target SoR45. To be Published
    Site NESGC
    PDB Id 1tza Target Id SoR45
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9149,PF04379, 2.60.40.1470 Molecular Weight 13859.83 Da.
    Residues 126 Isoelectric Point 4.78
    Sequence msaldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktsevqgagvv getptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgllh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.268
    Matthews' coefficent 2.56 Rfactor 0.217
    Waters 96 Solvent Content 52.00

    Ligand Information
    Ligands CAC (CACODYLATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1tza
    1. FRankenstein becomes a cyborg: the automatic recombination and realignment of fold recognition models in CASP6
    J Kosinski, MJ Gajda, IA Cymerman - PROTEINS: , 2005 - Wiley Online Library
     
    2. Solution structure of a late embryogenesis abundant protein (LEA14) from Arabidopsis thaliana, a cellular stress_related protein
    S Singh, CC Cornilescu, RC Tyler - Protein , 2005 - Wiley Online Library
     
    3. Assessment of CASP6 predictions for new and nearly new fold targets
    JJ Vincent, CH Tai - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    4. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    5. Protein structure prediction using a variety of profile libraries and 3D verification
    K Tomii, T Hirokawa, C Motono - : Structure, Function, and , 2005 - Wiley Online Library
     
    6. Protein structure prediction: The next generation
    MC Prentiss, C Hardin, MP Eastwood - Journal of Chemical , 2006 - ACS Publications
     
    7. Local descriptors of protein structure: A systematic analysis of the sequence_structure relationship in proteins using short_and long_range interactions
    TR Hvidsten, A Kryshtafovych - : Structure, Function, and , 2009 - Wiley Online Library
     
    8. Solution structure of ApaG from Xanthomonas axonopodis pv. citri reveals a fibronectin_3 fold
    DO Cicero, GM Contessa, TA Pertinhez - Proteins: Structure, , 2007 - Wiley Online Library
     
    9. Evaluation of the structural quality of modeled proteins by using globularity criteria
    S Costantini, AM Facchiano - BMC structural biology, 2007 - biomedcentral.com
     
    10. In silico chaperonin-like cycle helps folding of proteins for structure prediction
    T Furuta, Y Fujitsuka, G Chikenji, S Takada - Biophysical journal, 2008 - Elsevier
     
    11. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    12. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    13. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    14. Soft energy function and generic evolutionary method for discriminating native from nonnative protein conformations
    Y Chiu, J Hwang, J Yang - Journal of computational chemistry, 2008 - Wiley Online Library
     
    15. Experiment planning for protein structure elucidation and site-directed protein recombination
    X Ye - 2007 - cs.dartmouth.edu
     
    16. _________ FORTE ________________
    _____ - ____, 2006 - J-STAGE
     
    17. Protein Structure Prediction Using a Profile-Profile Comparison Method: FORTE
    _____ - ____, 2006 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch