.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wpi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of YKR049C, a putative redox protein from Saccharomyces cerevisiae. J.Biochem.Mol.Biol. 38 550-554 2005
    Site NESGC
    PDB Id 1wpi Target Id YTYst250
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9266,PF07955 Molecular Weight 15649.28 Da.
    Residues 133 Isoelectric Point 9.37
    Sequence msfwktlqrqprtislftndiasniksqkclqllkgdvshrfdveianrfptwdqlqymrtscpqgpvs lqrqipkldsvlkykhtdptfgmdlqkcvqrglwnpkealwvdwenklvgnepadidkyiiqrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wpi
    1. Solution structure of YKR049C, a putative redox protein from Saccharomyces cerevisiae
    J Jung, A Yee, B Wu, CH Arrowsmith - Journal of Biochemistry , 2005 - jbmb.or.kr
     
    2. How Accurately Can We Model Protein Structures with Dihedral Angles?
    X Cui, S Li, D Bu, B Alipanahi Ramandi, M Li - Algorithms in Bioinformatics, 2012 - Springer
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch